(data stored in ACNUC7421 zone)

EMBL: CP000038.YACE

CP000038.YACE        Location/Qualifiers
FT   CDS             complement(121826..122446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacE"
FT                   /locus_tag="SSON_0111"
FT                   /old_locus_tag="SSO_0111"
FT                   /product="putative DNA repair protein"
FT                   /note="Code: H; COG: COG0237"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86906"
FT                   /db_xref="GOA:Q3Z5Q6"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z5Q6"
FT                   /protein_id="AAZ86906.1"
FT                   /translation="MRYIVALTGGIGSGKSTVANAFADLGINVIDADIIARQVVEPGAP
FT                   ALHAIADHFGANMIAADGTLQRRALRERIFANPEEKNWLNALLHPLIQQETQHQIQQAT
FT                   SPYVLWVVPLLVENSLYKKANRVLVVDVSPETQLKRTMQRDDVTREHVEQILAAQATRE
FT                   ARLAVADDVIDNNGAPDAIASDVARLHAHYLQLASQFVSQEKP"
     MRYIVALTGG IGSGKSTVAN AFADLGINVI DADIIARQVV EPGAPALHAI ADHFGANMIA        60
     ADGTLQRRAL RERIFANPEE KNWLNALLHP LIQQETQHQI QQATSPYVLW VVPLLVENSL       120
     YKKANRVLVV DVSPETQLKR TMQRDDVTRE HVEQILAAQA TREARLAVAD DVIDNNGAPD       180
     AIASDVARLH AHYLQLASQF VSQEKP                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page