(data stored in ACNUC7421 zone)

EMBL: CP000038.YACG

CP000038.YACG        Location/Qualifiers
FT   CDS             complement(120876..121073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacG"
FT                   /locus_tag="SSON_0109"
FT                   /old_locus_tag="SSO_0109"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG3024"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86904"
FT                   /db_xref="GOA:Q3Z5Q8"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z5Q8"
FT                   /protein_id="AAZ86904.1"
FT                   /translation="MSETITVNCPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEK
FT                   RIPSSGDLSESDDWSEEPKQ"
     MSETITVNCP TCGKTVVWGE ISPFRPFCSK RCQLIDLGEW AAEEKRIPSS GDLSESDDWS        60
     EEPKQ                                                                    65
//

If you have problems or comments...

PBIL Back to PBIL home page