(data stored in ACNUC7421 zone)

EMBL: CP000038.YACL

CP000038.YACL        Location/Qualifiers
FT   CDS             143519..143881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacL"
FT                   /locus_tag="SSON_0127"
FT                   /old_locus_tag="SSO_0127"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG3112"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86921"
FT                   /db_xref="InterPro:IPR008249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z5P1"
FT                   /protein_id="AAZ86921.1"
FT                   /translation="MDYEFLRDITGVVKVRMSMGHEVVGHWFNEEVKENLALLDEVEQA
FT                   AHALKGSERSWQRAGHEYTLWMDGEEVMVRANQLEFAGDEMEEGMNYYDEESLSLCGVE
FT                   DFLQVVAAYRNFVQQK"
     MDYEFLRDIT GVVKVRMSMG HEVVGHWFNE EVKENLALLD EVEQAAHALK GSERSWQRAG        60
     HEYTLWMDGE EVMVRANQLE FAGDEMEEGM NYYDEESLSL CGVEDFLQVV AAYRNFVQQK       120
//

If you have problems or comments...

PBIL Back to PBIL home page