(data stored in ACNUC7421 zone)

EMBL: CP000038.YADD

CP000038.YADD        Location/Qualifiers
FT   CDS             155887..156840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadD"
FT                   /locus_tag="SSON_0140"
FT                   /old_locus_tag="SSO_0140"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG5464"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86934"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5M8"
FT                   /protein_id="AAZ86934.1"
FT                   /translation="MARLDWILPSRKTTRKAGKMDAPSTTPHDAVFKQFLMHAETARDF
FT                   LEIHLPVELRELCDLNTLHLESGSFIEESLKGHSTDVLYSVQMQGNPGYLHVVIEHQSK
FT                   PDKKMVFRMMRYSIAAMHRHLEADHDKLPLVVPILFYQGEATPYPLSMCWFDIFYSPEL
FT                   ARRVYNSPFPLVDITITPDDEIMQHRRIAILELLQKHIRQRDLMLLLEQLVTLIDEGYT
FT                   SGSQLVAMQNYMLQRGHTEQADLFYGVLRDRETGGESMMTLAQWFEEKGIEKGIQQGRQ
FT                   EERQEFAQRFLSKGMSREDVAEMTNLSLAEIDRLIN"
     MARLDWILPS RKTTRKAGKM DAPSTTPHDA VFKQFLMHAE TARDFLEIHL PVELRELCDL        60
     NTLHLESGSF IEESLKGHST DVLYSVQMQG NPGYLHVVIE HQSKPDKKMV FRMMRYSIAA       120
     MHRHLEADHD KLPLVVPILF YQGEATPYPL SMCWFDIFYS PELARRVYNS PFPLVDITIT       180
     PDDEIMQHRR IAILELLQKH IRQRDLMLLL EQLVTLIDEG YTSGSQLVAM QNYMLQRGHT       240
     EQADLFYGVL RDRETGGESM MTLAQWFEEK GIEKGIQQGR QEERQEFAQR FLSKGMSRED       300
     VAEMTNLSLA EIDRLIN                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page