(data stored in ACNUC7421 zone)

EMBL: CP000038.YADI

CP000038.YADI        Location/Qualifiers
FT   CDS             153553..153993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadI"
FT                   /locus_tag="SSON_0137"
FT                   /old_locus_tag="SSO_0137"
FT                   /product="putative PTS system enzyme IIB component"
FT                   /note="Code: G; COG: COG2893"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86931"
FT                   /db_xref="GOA:Q3Z5N1"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5N1"
FT                   /protein_id="AAZ86931.1"
FT                   /translation="MLGWVITCHDDRAQEILDALEKKHGALLQCRAVNFWRGLSSNMLS
FT                   RMMCDALHEADSGEGVIFLTDIAGAPPYRVASLLSHKHSRCEVISGVTLPLIEQMMACR
FT                   ETMTSSEFRERIVELGGPEVSSLWHQQQKNPPFVLKHNLYEY"
     MLGWVITCHD DRAQEILDAL EKKHGALLQC RAVNFWRGLS SNMLSRMMCD ALHEADSGEG        60
     VIFLTDIAGA PPYRVASLLS HKHSRCEVIS GVTLPLIEQM MACRETMTSS EFRERIVELG       120
     GPEVSSLWHQ QQKNPPFVLK HNLYEY                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page