(data stored in ACNUC7421 zone)

EMBL: CP000038.YADK

CP000038.YADK        Location/Qualifiers
FT   CDS             complement(162339..162935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadK"
FT                   /locus_tag="SSON_0145"
FT                   /old_locus_tag="SSO_0145"
FT                   /product="putative fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86939"
FT                   /db_xref="GOA:Q3Z5M3"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5M3"
FT                   /protein_id="AAZ86939.1"
FT                   /translation="MHPTQRKLMKRIILFLSLQFPITYPAIAGQDIDLVANVKNSTCKS
FT                   GISNQGNIDLGVVGVGYFSDNVTPESYQPGGKEFTVTVSDCALQGTGDVLNQLHIDFRA
FT                   LSGVMAAGSRQIFANEVATGAKNVGVVLFSIQDPTNIFNVISSAGNSRSVYPVMTSALH
FT                   NSSWKFYARMQKIDPALDVISGQVMSHILVDVYYE"
     MHPTQRKLMK RIILFLSLQF PITYPAIAGQ DIDLVANVKN STCKSGISNQ GNIDLGVVGV        60
     GYFSDNVTPE SYQPGGKEFT VTVSDCALQG TGDVLNQLHI DFRALSGVMA AGSRQIFANE       120
     VATGAKNVGV VLFSIQDPTN IFNVISSAGN SRSVYPVMTS ALHNSSWKFY ARMQKIDPAL       180
     DVISGQVMSH ILVDVYYE                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page