(data stored in ACNUC7421 zone)

EMBL: CP000038.YADP

CP000038.YADP        Location/Qualifiers
FT   CDS             complement(175698..176237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadP"
FT                   /locus_tag="SSON_0159"
FT                   /old_locus_tag="SSO_0159"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: J; COG: COG1514"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86952"
FT                   /db_xref="GOA:Q3Z5L0"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR014051"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5L0"
FT                   /protein_id="AAZ86952.1"
FT                   /translation="MPHMSEPQRLFFAIDLPAEIREQIIHWRATHFPPEAGRPVAADNL
FT                   HLTLAFLGEVSAEKEKALSLLAGRIRQPGFTLTLDDAGQWLRSRVVWLGMRQPPRGLIQ
FT                   LANMLRSQAARSGCFQSNRPFHPHITLLRDASEAVTIPPPGFNWSYAVTEFTLYASSFA
FT                   RGRTRYTPLKRWALTQ"
     MPHMSEPQRL FFAIDLPAEI REQIIHWRAT HFPPEAGRPV AADNLHLTLA FLGEVSAEKE        60
     KALSLLAGRI RQPGFTLTLD DAGQWLRSRV VWLGMRQPPR GLIQLANMLR SQAARSGCFQ       120
     SNRPFHPHIT LLRDASEAVT IPPPGFNWSY AVTEFTLYAS SFARGRTRYT PLKRWALTQ        179
//

If you have problems or comments...

PBIL Back to PBIL home page