(data stored in ACNUC7421 zone)

EMBL: CP000038.YADS

CP000038.YADS        Location/Qualifiers
FT   CDS             complement(191144..191767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadS"
FT                   /locus_tag="SSON_0169"
FT                   /old_locus_tag="SSO_0169"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG2860"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86962"
FT                   /db_xref="GOA:Q3Z5K0"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5K0"
FT                   /protein_id="AAZ86962.1"
FT                   /translation="MLVYWLDIVGTAVFAISGVLLAGKLRMDPFGVLVLGVVTAVGGGT
FT                   IRDMALDHGPVFWVKDPTDLVVAMVTSMLTIVLVRQPRRLPKWMLPVLDAVGLAVFVGI
FT                   GVNKAFNAEVGPLIAVCMVVITGVGGGIIRDVLAREIPMILRTEIYATACIIGGIVHAT
FT                   AYYTFSVPLETASMMGMVVTLLIRLAAIRWHLKLPTFALDENGR"
     MLVYWLDIVG TAVFAISGVL LAGKLRMDPF GVLVLGVVTA VGGGTIRDMA LDHGPVFWVK        60
     DPTDLVVAMV TSMLTIVLVR QPRRLPKWML PVLDAVGLAV FVGIGVNKAF NAEVGPLIAV       120
     CMVVITGVGG GIIRDVLARE IPMILRTEIY ATACIIGGIV HATAYYTFSV PLETASMMGM       180
     VVTLLIRLAA IRWHLKLPTF ALDENGR                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page