(data stored in ACNUC7421 zone)

EMBL: CP000038.YAER

CP000038.YAER        Location/Qualifiers
FT   CDS             228210..228626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeR"
FT                   /locus_tag="SSON_0200"
FT                   /old_locus_tag="SSO_0200"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: E; COG: COG0346"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86992"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037478"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5H0"
FT                   /protein_id="AAZ86992.1"
FT                   /translation="MLLTNKGDVMLGLKQVHHIAIIATDYAVSKAFYCDILGFTLQSEV
FT                   YREARDSWKGDLALNGQYVIELFSFPFPPERPSRPEACGLRHLAFSVDDIDAAVAHLES
FT                   HNVKCEAIRVDPYTQKRFTFFNDPDGLPLELYEQ"
     MLLTNKGDVM LGLKQVHHIA IIATDYAVSK AFYCDILGFT LQSEVYREAR DSWKGDLALN        60
     GQYVIELFSF PFPPERPSRP EACGLRHLAF SVDDIDAAVA HLESHNVKCE AIRVDPYTQK       120
     RFTFFNDPDG LPLELYEQ                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page