(data stored in ACNUC7421 zone)

EMBL: CP000038.YAFQ

CP000038.YAFQ        Location/Qualifiers
FT   CDS             complement(296108..296386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafQ"
FT                   /locus_tag="SSON_0267"
FT                   /old_locus_tag="SSO_0267"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG3041"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87051"
FT                   /db_xref="InterPro:IPR004386"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5B1"
FT                   /protein_id="AAZ87051.1"
FT                   /translation="MIQRDIEYSGQFSKDVKLAQKRHKDMNKLKYLMTLLINNALPLPA
FT                   VYKDHPLQGSWKGYRDAHVEPDWILIYKLTDKLLRFERTGTHAALFG"
     MIQRDIEYSG QFSKDVKLAQ KRHKDMNKLK YLMTLLINNA LPLPAVYKDH PLQGSWKGYR        60
     DAHVEPDWIL IYKLTDKLLR FERTGTHAAL FG                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page