(data stored in ACNUC7421 zone)

EMBL: CP000038.YAFU

CP000038.YAFU        Location/Qualifiers
FT   CDS             complement(255186..255524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafU"
FT                   /locus_tag="SSON_0232"
FT                   /old_locus_tag="SSO_0232"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87016"
FT                   /db_xref="GOA:Q3Z5E6"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5E6"
FT                   /protein_id="AAZ87016.1"
FT                   /translation="MSSERDLVNFLGDFSMDVAKAVIAGGVATAIGSLASFACVSFGFP
FT                   VILVGGAILLTGIVCTVVLNEIDAQCHLSEKLKYAIRDGLKRQQELDKWKRENMTPFMY
FT                   VLNTPPVI"
     MSSERDLVNF LGDFSMDVAK AVIAGGVATA IGSLASFACV SFGFPVILVG GAILLTGIVC        60
     TVVLNEIDAQ CHLSEKLKYA IRDGLKRQQE LDKWKRENMT PFMYVLNTPP VI               112
//

If you have problems or comments...

PBIL Back to PBIL home page