(data stored in ACNUC7421 zone)

EMBL: CP000038.YAHE

CP000038.YAHE        Location/Qualifiers
FT   CDS             complement(343444..344307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahE"
FT                   /locus_tag="SSON_0313"
FT                   /old_locus_tag="SSO_0313"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87092"
FT                   /db_xref="InterPro:IPR021530"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z570"
FT                   /protein_id="AAZ87092.1"
FT                   /translation="MWALTADADFLAQRGQGQVEQVFARAVNIALPARQQLLTLLCEEY
FT                   DNAPNSCRLALTHFDDLFRHGDKVQFDDQGITVGQHLHIEMSRCRRWLSPTLQMTAVNF
FT                   HLIAWLQWHDIIHQHLGENETLFNYRGDNPFYQALNKELHIKRRAVIQTVNDKQNIAAA
FT                   VASMIGLGIGLTPSADDYLTGLALILFIPGHPAEKYKEEFYRGLLRGRNNTTLLSAITL
FT                   EAALQQRCRENIHRFIHNIIYGVPGNSTQAIEKIKHIGSSSGCDMLYGMADGCALSQTY
FT                   GGNYVS"
     MWALTADADF LAQRGQGQVE QVFARAVNIA LPARQQLLTL LCEEYDNAPN SCRLALTHFD        60
     DLFRHGDKVQ FDDQGITVGQ HLHIEMSRCR RWLSPTLQMT AVNFHLIAWL QWHDIIHQHL       120
     GENETLFNYR GDNPFYQALN KELHIKRRAV IQTVNDKQNI AAAVASMIGL GIGLTPSADD       180
     YLTGLALILF IPGHPAEKYK EEFYRGLLRG RNNTTLLSAI TLEAALQQRC RENIHRFIHN       240
     IIYGVPGNST QAIEKIKHIG SSSGCDMLYG MADGCALSQT YGGNYVS                     287
//

If you have problems or comments...

PBIL Back to PBIL home page