(data stored in ACNUC7421 zone)

EMBL: CP000038.YAHF

CP000038.YAHF        Location/Qualifiers
FT   CDS             complement(341907..343454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahF"
FT                   /locus_tag="SSON_0312"
FT                   /old_locus_tag="SSO_0312"
FT                   /product="putative oxidoreductase subunit"
FT                   /note="Code: C; COG: COG0074"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87091"
FT                   /db_xref="GOA:Q3Z571"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z571"
FT                   /protein_id="AAZ87091.1"
FT                   /translation="MSVKIVIKPNTYFDSVSLMSISTRANKLDGVEQAFVAMATEMNKG
FT                   VLKNLGLLTPTLEQAKNGDLMIVINGKSGADNEQLLVEIEELFNTKAQSGSHEARYATI
FT                   ASAKKHIPESNLAVISVNGLFAAREARQALQNDLNVMLFSDNVSVEDELALKQLAHEKG
FT                   LLMMGPDCGTAIINGAALCFGNAVRRGNIGIVGASGTGSQELSVRIHEFGGGVSQLIGT
FT                   GGRDLSEKIGGLMMLDAIGMLENDPQTEIIALISKPPAPAVARKVLERARACRKPVVVC
FT                   FLGRVETPVDEQGLQFARGSKEAVLKAVMLSGVKQENLDLHTLNQPLIADVRARLQPQQ
FT                   KYIRGLFCGGTLCDETMFAVMEKHGDVYSNIQPDPEFRLQDINRSIKHTFLDFGDDDFT
FT                   NGKPHPMIDPTNRISRLIEEARDPEVAVIVMDFVLGFGSHEDPVGSTIEAIKEAKAIAA
FT                   AEGRELIILAYVLGTDLDTPSLEQQSQMLLDAGVILASSSTNTGLLAREFICKGEEA"
     MSVKIVIKPN TYFDSVSLMS ISTRANKLDG VEQAFVAMAT EMNKGVLKNL GLLTPTLEQA        60
     KNGDLMIVIN GKSGADNEQL LVEIEELFNT KAQSGSHEAR YATIASAKKH IPESNLAVIS       120
     VNGLFAAREA RQALQNDLNV MLFSDNVSVE DELALKQLAH EKGLLMMGPD CGTAIINGAA       180
     LCFGNAVRRG NIGIVGASGT GSQELSVRIH EFGGGVSQLI GTGGRDLSEK IGGLMMLDAI       240
     GMLENDPQTE IIALISKPPA PAVARKVLER ARACRKPVVV CFLGRVETPV DEQGLQFARG       300
     SKEAVLKAVM LSGVKQENLD LHTLNQPLIA DVRARLQPQQ KYIRGLFCGG TLCDETMFAV       360
     MEKHGDVYSN IQPDPEFRLQ DINRSIKHTF LDFGDDDFTN GKPHPMIDPT NRISRLIEEA       420
     RDPEVAVIVM DFVLGFGSHE DPVGSTIEAI KEAKAIAAAE GRELIILAYV LGTDLDTPSL       480
     EQQSQMLLDA GVILASSSTN TGLLAREFIC KGEEA                                  515
//

If you have problems or comments...

PBIL Back to PBIL home page