(data stored in ACNUC7421 zone)

EMBL: CP000038.YAHL

CP000038.YAHL        Location/Qualifiers
FT   CDS             complement(334803..335618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahL"
FT                   /locus_tag="SSON_0306"
FT                   /old_locus_tag="SSO_0306"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87085"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z577"
FT                   /protein_id="AAZ87085.1"
FT                   /translation="MISLKAPHNNLMPYTQQSILNTVKNNQLPEDIKSSLVSCVDIFKV
FT                   LIKQYYDYPYDCRDDLVDDDKLIHLMAAVRDCEWSDDNALTINVQFNDFPGFYDWMDYP
FT                   DHPVKFVFRILENQKGTVWVYDQDDAFLDIKANVQAGRFTGLKKLVQFINSVRTDCKCI
FT                   LLEHHMPLLRLFPKGKECMHVEKWLREMSSIPETDAPIKQALAHGLLLHLKNIYPVFPE
FT                   SLVMLLLSVLDVKTYRDDARLNEWISNRVQELGDRYYPVNKHVKIRYTL"
     MISLKAPHNN LMPYTQQSIL NTVKNNQLPE DIKSSLVSCV DIFKVLIKQY YDYPYDCRDD        60
     LVDDDKLIHL MAAVRDCEWS DDNALTINVQ FNDFPGFYDW MDYPDHPVKF VFRILENQKG       120
     TVWVYDQDDA FLDIKANVQA GRFTGLKKLV QFINSVRTDC KCILLEHHMP LLRLFPKGKE       180
     CMHVEKWLRE MSSIPETDAP IKQALAHGLL LHLKNIYPVF PESLVMLLLS VLDVKTYRDD       240
     ARLNEWISNR VQELGDRYYP VNKHVKIRYT L                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page