(data stored in ACNUC7421 zone)

EMBL: CP000038.YAHN

CP000038.YAHN        Location/Qualifiers
FT   CDS             332229..332861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahN"
FT                   /locus_tag="SSON_0302"
FT                   /old_locus_tag="SSO_0302"
FT                   /product="putative cytochrome subunit of dehydrogenase"
FT                   /note="Code: E; COG: COG1280"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87081"
FT                   /db_xref="GOA:Q3Z581"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="InterPro:IPR004778"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z581"
FT                   /protein_id="AAZ87081.1"
FT                   /translation="MDPLHAVYLTVGLFVITFFNPGANLFVVVQTSLASGRRAGVLTGL
FT                   GVALGDAFYSGLGLFGLATLITQCEEIFSLIRIVGGAYLLWFAWCSMRRQSTPQMSTLQ
FT                   QPISASWYVFFRRGLITDLSNPQTVLFFISIFSVTLNAETPTWARLMAWAGIVLASVIW
FT                   RVFLSQAFSLPAVRRAYGRMQRVASRVIGAIIGVFALRLIYEGVTQR"
     MDPLHAVYLT VGLFVITFFN PGANLFVVVQ TSLASGRRAG VLTGLGVALG DAFYSGLGLF        60
     GLATLITQCE EIFSLIRIVG GAYLLWFAWC SMRRQSTPQM STLQQPISAS WYVFFRRGLI       120
     TDLSNPQTVL FFISIFSVTL NAETPTWARL MAWAGIVLAS VIWRVFLSQA FSLPAVRRAY       180
     GRMQRVASRV IGAIIGVFAL RLIYEGVTQR                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page