(data stored in ACNUC7421 zone)

EMBL: CP000038.YAIE

CP000038.YAIE        Location/Qualifiers
FT   CDS             391566..391850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiE"
FT                   /locus_tag="SSON_0367"
FT                   /old_locus_tag="SSO_0367"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG3123"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87143"
FT                   /db_xref="GOA:Q3Z519"
FT                   /db_xref="InterPro:IPR009664"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z519"
FT                   /protein_id="AAZ87143.1"
FT                   /translation="MLQSNEYFSGKVKSIGFSSSSTGRASVGVMVEGEYTFSTAEPEEM
FT                   TVISGALNVLLPDATDWQVYEAGSVFNVPGHSEFHLQVAEPTSYLCRYL"
     MLQSNEYFSG KVKSIGFSSS STGRASVGVM VEGEYTFSTA EPEEMTVISG ALNVLLPDAT        60
     DWQVYEAGSV FNVPGHSEFH LQVAEPTSYL CRYL                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page