(data stored in ACNUC7421 zone)

EMBL: CP000038.YAIL

CP000038.YAIL        Location/Qualifiers
FT   CDS             360741..361397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiL"
FT                   /locus_tag="SSON_0333"
FT                   /old_locus_tag="SSO_0333"
FT                   /product="nucleoprotein/polynucleotide-associated enzyme"
FT                   /note="Code: S; COG: COG3122"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87110"
FT                   /db_xref="InterPro:IPR018636"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z552"
FT                   /protein_id="AAZ87110.1"
FT                   /translation="MCRCLTRLIKQGRKGLAPNTPTAFTGILAKNYSAGLETKMAKLTL
FT                   QEQLLKAGLVTSKKAAKVERTAKKSRVQAREARAAVEENKKAQLERDKQLSEQQKQAAL
FT                   AKEYKAQVKQLIEMNRITIANGDIGFNFTDGNLIKKIFVDKLTQAQLINGRLAIARLLV
FT                   DNNSEGEYTIIPASVADKIAQRDASSIVLHSALSAEEQDEDDPYADFKVPDDLMW"
     MCRCLTRLIK QGRKGLAPNT PTAFTGILAK NYSAGLETKM AKLTLQEQLL KAGLVTSKKA        60
     AKVERTAKKS RVQAREARAA VEENKKAQLE RDKQLSEQQK QAALAKEYKA QVKQLIEMNR       120
     ITIANGDIGF NFTDGNLIKK IFVDKLTQAQ LINGRLAIAR LLVDNNSEGE YTIIPASVAD       180
     KIAQRDASSI VLHSALSAEE QDEDDPYADF KVPDDLMW                               218
//

If you have problems or comments...

PBIL Back to PBIL home page