(data stored in ACNUC7421 zone)

EMBL: CP000038.YAIS

CP000038.YAIS        Location/Qualifiers
FT   CDS             complement(366697..367368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiS"
FT                   /locus_tag="SSON_0340"
FT                   /old_locus_tag="SSO_0340"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG2120"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87116"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z546"
FT                   /protein_id="AAZ87116.1"
FT                   /translation="MDKVLDSALLSSANKRKGILAIGAHPDDIELGCGASLARLAQKGI
FT                   YIAAVVMTTGNSGTDGIIDRHEESRNALKILGCNQTIHLNFADTRAHLQLNDMISALED
FT                   IIKNQIPSDVEIMRVYTMHDADRHQDHLAVYQASMVACRTIPQILGYETPSTWLSFMPQ
FT                   VFESVKEEYFTVKLAALKKHKSQERRDYMRHDRLRAVAQFRGQQVNSDLGEGFVIHKMI
FT                   L"
     MDKVLDSALL SSANKRKGIL AIGAHPDDIE LGCGASLARL AQKGIYIAAV VMTTGNSGTD        60
     GIIDRHEESR NALKILGCNQ TIHLNFADTR AHLQLNDMIS ALEDIIKNQI PSDVEIMRVY       120
     TMHDADRHQD HLAVYQASMV ACRTIPQILG YETPSTWLSF MPQVFESVKE EYFTVKLAAL       180
     KKHKSQERRD YMRHDRLRAV AQFRGQQVNS DLGEGFVIHK MIL                         223
//

If you have problems or comments...

PBIL Back to PBIL home page