(data stored in ACNUC7421 zone)

EMBL: CP000038.YAJI

CP000038.YAJI        Location/Qualifiers
FT   CDS             complement(417406..418005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajI"
FT                   /locus_tag="SSON_0389"
FT                   /old_locus_tag="SSO_0389"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87165"
FT                   /db_xref="InterPro:IPR021658"
FT                   /db_xref="InterPro:IPR037125"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z4Z7"
FT                   /protein_id="AAZ87165.1"
FT                   /translation="MLSLLLPSTIRLIATRKGRPMNTNVFRLLLLGSLFSLSACVQQSE
FT                   VRQMKHSVSTLNQEMTQLNQETVKITQQNRLNAKSSSGVYLLPGAKTPARLESQIGTLR
FT                   MSLVNITPDTDGTTLTLRIQGESNDPLPAFSGTVEYGQIQGTIDNFQEINVQNQLINAP
FT                   ASVLAPSDVDIPLQLKGISVDQLGFVRIHDIQPVMQ"
     MLSLLLPSTI RLIATRKGRP MNTNVFRLLL LGSLFSLSAC VQQSEVRQMK HSVSTLNQEM        60
     TQLNQETVKI TQQNRLNAKS SSGVYLLPGA KTPARLESQI GTLRMSLVNI TPDTDGTTLT       120
     LRIQGESNDP LPAFSGTVEY GQIQGTIDNF QEINVQNQLI NAPASVLAPS DVDIPLQLKG       180
     ISVDQLGFVR IHDIQPVMQ                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page