(data stored in ACNUC7421 zone)

EMBL: CP000038.YBAA

CP000038.YBAA        Location/Qualifiers
FT   CDS             468869..469222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaA"
FT                   /locus_tag="SSON_0443"
FT                   /old_locus_tag="SSO_0443"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG5507"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87219"
FT                   /db_xref="InterPro:IPR009874"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z4U3"
FT                   /protein_id="AAZ87219.1"
FT                   /translation="MKYVDGFVVAVPADKKDAYREMAAKAAPLFKEFGALRIVECWASD
FT                   VPDGKVTDFRMAVKAEENEEVVFSWIEYPSKEVRDAANQKMMSDPRMKEFGESMPFDGK
FT                   RMIYGGFESIIDE"
     MKYVDGFVVA VPADKKDAYR EMAAKAAPLF KEFGALRIVE CWASDVPDGK VTDFRMAVKA        60
     EENEEVVFSW IEYPSKEVRD AANQKMMSDP RMKEFGESMP FDGKRMIYGG FESIIDE          117
//

If you have problems or comments...

PBIL Back to PBIL home page