(data stored in ACNUC7421 zone)

EMBL: CP000038.YBAD

CP000038.YBAD        Location/Qualifiers
FT   CDS             418096..418545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaD"
FT                   /locus_tag="SSON_0390"
FT                   /old_locus_tag="SSO_0390"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: K; COG: COG1327"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87166"
FT                   /db_xref="GOA:Q3Z4Z6"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z4Z6"
FT                   /protein_id="AAZ87166.1"
FT                   /translation="MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAE
FT                   LVMPRVVKSNDVREPFNEEKLRSGMLRALEKRPVSSDDVEMAINHIKSQLRATGEREVP
FT                   SKMIGNLVMEQLKKLDKVAYIRFASVYRSFEDIKEFGEEIARLED"
     MHCPFCFAVD TKVIDSRLVG EGSSVRRRRQ CLVCNERFTT FEVAELVMPR VVKSNDVREP        60
     FNEEKLRSGM LRALEKRPVS SDDVEMAINH IKSQLRATGE REVPSKMIGN LVMEQLKKLD       120
     KVAYIRFASV YRSFEDIKEF GEEIARLED                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page