(data stored in ACNUC7421 zone)

EMBL: CP000038.YBAL

CP000038.YBAL        Location/Qualifiers
FT   CDS             complement(493646..495322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaL"
FT                   /locus_tag="SSON_0465"
FT                   /old_locus_tag="SSO_0465"
FT                   /product="putative transport protein"
FT                   /note="Code: P; COG: COG4651"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87241"
FT                   /db_xref="GOA:Q3Z4S1"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z4S1"
FT                   /protein_id="AAZ87241.1"
FT                   /translation="MHHATPLITTIVGGLVLAFILGMLANKLRISPLVGYLLAGVLAGP
FT                   FTPGFVADTKLAPELAELGVILLMFGVGLHFSLKDLMAVKAIAIPGAIAQIAVATLLGM
FT                   ALSAVLGWSLMTGIVFGLCLSTASTVVLLRALEERQLIDSQRGQIAIGWLIVEDLVMVL
FT                   TLVLLPAVAGMMEQGDVGFATLAVDMGITIGKVIAFIAIMMLVGRRLVPWIMARSAATG
FT                   SRELFTLSVLALALGIAFGAVELFDVSFALGAFFAGMVLNESELSHRAAHDTLPLRDAF
FT                   AVLFFVSVGMLFDPLILIQQPLAVLATLAIILFGKSVAALFLVRLFGHSQRTALTIAAS
FT                   LAQIGEFAFILAGLGMALNLLPQAGQNLVLAGAILSIMLNPVLFALLEKYLAKTETLEE
FT                   QTLEEAIEEEKQIPVDICNHALLVGYGRVGSLLGEKLLASDIPLVVIETSRTRVDELRE
FT                   RGVRAVLGNAANEEIMQLAHLECAKWLILTIPNGYEAGEIVASARAKNPDIEIIARAHY
FT                   DDEVTYITERGANQVVMGEREIARTMLELLETPPAGEVVTG"
     MHHATPLITT IVGGLVLAFI LGMLANKLRI SPLVGYLLAG VLAGPFTPGF VADTKLAPEL        60
     AELGVILLMF GVGLHFSLKD LMAVKAIAIP GAIAQIAVAT LLGMALSAVL GWSLMTGIVF       120
     GLCLSTASTV VLLRALEERQ LIDSQRGQIA IGWLIVEDLV MVLTLVLLPA VAGMMEQGDV       180
     GFATLAVDMG ITIGKVIAFI AIMMLVGRRL VPWIMARSAA TGSRELFTLS VLALALGIAF       240
     GAVELFDVSF ALGAFFAGMV LNESELSHRA AHDTLPLRDA FAVLFFVSVG MLFDPLILIQ       300
     QPLAVLATLA IILFGKSVAA LFLVRLFGHS QRTALTIAAS LAQIGEFAFI LAGLGMALNL       360
     LPQAGQNLVL AGAILSIMLN PVLFALLEKY LAKTETLEEQ TLEEAIEEEK QIPVDICNHA       420
     LLVGYGRVGS LLGEKLLASD IPLVVIETSR TRVDELRERG VRAVLGNAAN EEIMQLAHLE       480
     CAKWLILTIP NGYEAGEIVA SARAKNPDIE IIARAHYDDE VTYITERGAN QVVMGEREIA       540
     RTMLELLETP PAGEVVTG                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page