(data stored in ACNUC7421 zone)

EMBL: CP000038.YBAQ

CP000038.YBAQ        Location/Qualifiers
FT   CDS             501515..501910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaQ"
FT                   /locus_tag="SSON_0472"
FT                   /old_locus_tag="SSO_0472"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: R; COG: COG3093"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87248"
FT                   /db_xref="GOA:Q3Z4R4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z4R4"
FT                   /protein_id="AAZ87248.1"
FT                   /translation="MIQYVLASLFTGKQQLKTMKQATRKPTTPGDILLYEYLEPLDLKI
FT                   NELAELLHVHRNSVSALINNNRKLTTEMAFRLAKVFDTTVDFRLNLQAAVDLWEVENNM
FT                   RTQEELGRIETVAEYLARREERAKKVA"
     MIQYVLASLF TGKQQLKTMK QATRKPTTPG DILLYEYLEP LDLKINELAE LLHVHRNSVS        60
     ALINNNRKLT TEMAFRLAKV FDTTVDFRLN LQAAVDLWEV ENNMRTQEEL GRIETVAEYL       120
     ARREERAKKV A                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page