(data stored in ACNUC7421 zone)

EMBL: CP000038.YBBB

CP000038.YBBB        Location/Qualifiers
FT   CDS             complement(516314..517408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbB"
FT                   /locus_tag="SSON_0486"
FT                   /old_locus_tag="SSO_0486"
FT                   /product="putative capsule anchoring protein"
FT                   /note="Code: R; COG: COG2603"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87262"
FT                   /db_xref="GOA:Q3Z4Q0"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR017582"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z4Q0"
FT                   /protein_id="AAZ87262.1"
FT                   /translation="MQERHTEQDYRALLIADTPIIDVRAPIEFEQGAMPAAINLPLMNN
FT                   DERAAVGTCYKQQGSDAALALGHKLVAGEIRQQRMDAWRAACLQNPQGILCCARGGQRS
FT                   HIVQSWLYAAGIDYPLVEGGYKALRQAAIQATIELAQKPIVLIGGCTGSGKTLLVQQQP
FT                   NGVDLEGLARHRGSAFGRTLQPQLSQASFENLLAAEMLKTDARQDLRLWVLEDESRMIG
FT                   SNHLPECLRERMTQAAIAVVEDPFEIRLERLNEEYFLRMHHDFTHAYGDEQGWQEYCEY
FT                   LHHGLSAIKRRLGLQRYNELAAQLDTALTTQLTTDSTDGHLAWLVPLLKEYYDPMYRYQ
FT                   LEKKAEKVVFRGEWAEVAEWVKTQ"
     MQERHTEQDY RALLIADTPI IDVRAPIEFE QGAMPAAINL PLMNNDERAA VGTCYKQQGS        60
     DAALALGHKL VAGEIRQQRM DAWRAACLQN PQGILCCARG GQRSHIVQSW LYAAGIDYPL       120
     VEGGYKALRQ AAIQATIELA QKPIVLIGGC TGSGKTLLVQ QQPNGVDLEG LARHRGSAFG       180
     RTLQPQLSQA SFENLLAAEM LKTDARQDLR LWVLEDESRM IGSNHLPECL RERMTQAAIA       240
     VVEDPFEIRL ERLNEEYFLR MHHDFTHAYG DEQGWQEYCE YLHHGLSAIK RRLGLQRYNE       300
     LAAQLDTALT TQLTTDSTDG HLAWLVPLLK EYYDPMYRYQ LEKKAEKVVF RGEWAEVAEW       360
     VKTQ                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page