(data stored in ACNUC7421 zone)

EMBL: CP000038.YBBF

CP000038.YBBF        Location/Qualifiers
FT   CDS             523345..524067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbF"
FT                   /locus_tag="SSON_0494"
FT                   /old_locus_tag="SSO_0494"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG2908"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87269"
FT                   /db_xref="GOA:Q3Z4P3"
FT                   /db_xref="InterPro:IPR010138"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z4P3"
FT                   /protein_id="AAZ87269.1"
FT                   /translation="MATLFIADLHLCVEEPAITAGFLRFLAGEARKADALYILGDLFEA
FT                   WIGDDEPNPLHRQMAAAIKAVSDSGVPCYFIHGNRDFLLGKRFARESGMTLLPEEKVLE
FT                   LYGRRVLIMHGDTLCTDDAGYQAFRAKVHKPWLQMLFLALPLFVRKRIAARMRANSKEA
FT                   NSSKSLAIMDVNQNAVVSAMEKHQVQWLIHGHTHRPAVHELIANQQPAFRVVLGAWHTE
FT                   GSMVKVTADDVELIHFPF"
     MATLFIADLH LCVEEPAITA GFLRFLAGEA RKADALYILG DLFEAWIGDD EPNPLHRQMA        60
     AAIKAVSDSG VPCYFIHGNR DFLLGKRFAR ESGMTLLPEE KVLELYGRRV LIMHGDTLCT       120
     DDAGYQAFRA KVHKPWLQML FLALPLFVRK RIAARMRANS KEANSSKSLA IMDVNQNAVV       180
     SAMEKHQVQW LIHGHTHRPA VHELIANQQP AFRVVLGAWH TEGSMVKVTA DDVELIHFPF       240
//

If you have problems or comments...

PBIL Back to PBIL home page