(data stored in ACNUC7421 zone)

EMBL: CP000038.YBCH

CP000038.YBCH        Location/Qualifiers
FT   CDS             complement(540746..541636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcH"
FT                   /locus_tag="SSON_0513"
FT                   /old_locus_tag="SSO_0513"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87283"
FT                   /db_xref="InterPro:IPR027849"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z4M9"
FT                   /protein_id="AAZ87283.1"
FT                   /translation="MRKFIFVLLTLLLVSPFSFAMKGIIWQPQNRDSQVTDTQWQGLMS
FT                   QLRLQGFDTLVLQWTRYGDAFTQPEQRTLLFKRAAAAQQAGLKLIVGLNADPEFFMHQK
FT                   QSSAALESYLNRLLAADLQQARLWSAAPGITPDGWYISAEIDDLNWRSEAARQPLLTWL
FT                   NNAQRLISDVSAKPVYISSFFAGNMSPDGYRQLLEQVKATGVNVWVQDGSGVDKLTAEQ
FT                   RERYLQASADCQSSAPASGIVYELFVAGKGKTFTAKPKPDAEIASLLAKRSSCGKDTLY
FT                   FSLRYLPVAHGILEY"
     MRKFIFVLLT LLLVSPFSFA MKGIIWQPQN RDSQVTDTQW QGLMSQLRLQ GFDTLVLQWT        60
     RYGDAFTQPE QRTLLFKRAA AAQQAGLKLI VGLNADPEFF MHQKQSSAAL ESYLNRLLAA       120
     DLQQARLWSA APGITPDGWY ISAEIDDLNW RSEAARQPLL TWLNNAQRLI SDVSAKPVYI       180
     SSFFAGNMSP DGYRQLLEQV KATGVNVWVQ DGSGVDKLTA EQRERYLQAS ADCQSSAPAS       240
     GIVYELFVAG KGKTFTAKPK PDAEIASLLA KRSSCGKDTL YFSLRYLPVA HGILEY           296
//

If you have problems or comments...

PBIL Back to PBIL home page