(data stored in ACNUC7421 zone)

EMBL: CP000038.YBCI

CP000038.YBCI        Location/Qualifiers
FT   CDS             520837..521253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcI"
FT                   /locus_tag="SSON_0491"
FT                   /old_locus_tag="SSO_0491"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: R; COG: COG1988"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87266"
FT                   /db_xref="GOA:Q3Z4P6"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z4P6"
FT                   /protein_id="AAZ87266.1"
FT                   /translation="MLPDADVLSFKFGVAYGNVFGHRGFTHSLVFAFVVPLLCVLIGRR
FT                   WFRAGLIRCWLFLTVSLLSHSMLDSVTTGGKGVGWLWPWSDERFFAPWQVIKVAPFALS
FT                   CYTTPYGHQVIISELMWVWLPGMLLMGMLWWRRR"
     MLPDADVLSF KFGVAYGNVF GHRGFTHSLV FAFVVPLLCV LIGRRWFRAG LIRCWLFLTV        60
     SLLSHSMLDS VTTGGKGVGW LWPWSDERFF APWQVIKVAP FALSCYTTPY GHQVIISELM       120
     WVWLPGMLLM GMLWWRRR                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page