(data stored in ACNUC7421 zone)

EMBL: CP000038.YBDK

CP000038.YBDK        Location/Qualifiers
FT   CDS             complement(566569..567687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdK"
FT                   /locus_tag="SSON_0532"
FT                   /old_locus_tag="SSO_0532"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG2170"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87300"
FT                   /db_xref="GOA:Q3Z4L2"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z4L2"
FT                   /protein_id="AAZ87300.1"
FT                   /translation="MPLPDFHVSEPFTLGIELEMQVVNPPGYDLSQDSSMLIDAVKNKI
FT                   TAGEVKHDITESMLELATDVCRDINQAAGQFSAMQKVVLQAAADHHLEICGGGTHPFQK
FT                   WQRQEVCDNERYQRTLENFGYLIQQATVFGQHVHVGCASGDDAIYLLHGLSRFVPHFIA
FT                   LSAASPYMQGTDTRFASSRPNIFSAFPDNGPMPWVSNWQQFEALFRCLSYTTMIDSIKD
FT                   LHWDIRPSPHFGTVEVRVMDTPLTLSHAVNMAGLIQATAHWLLTERPFKHQEKDYLLYK
FT                   FNRFQACRYGLEGVITDPHTGDRRPLTEDTLRLLEKIAPSAHKIGASSAIEALHRQVVS
FT                   GLNEAQLMRDFVADGGSLIGLVKKHCEIWADD"
     MPLPDFHVSE PFTLGIELEM QVVNPPGYDL SQDSSMLIDA VKNKITAGEV KHDITESMLE        60
     LATDVCRDIN QAAGQFSAMQ KVVLQAAADH HLEICGGGTH PFQKWQRQEV CDNERYQRTL       120
     ENFGYLIQQA TVFGQHVHVG CASGDDAIYL LHGLSRFVPH FIALSAASPY MQGTDTRFAS       180
     SRPNIFSAFP DNGPMPWVSN WQQFEALFRC LSYTTMIDSI KDLHWDIRPS PHFGTVEVRV       240
     MDTPLTLSHA VNMAGLIQAT AHWLLTERPF KHQEKDYLLY KFNRFQACRY GLEGVITDPH       300
     TGDRRPLTED TLRLLEKIAP SAHKIGASSA IEALHRQVVS GLNEAQLMRD FVADGGSLIG       360
     LVKKHCEIWA DD                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page