(data stored in ACNUC7421 zone)

EMBL: CP000038.YBDU

CP000038.YBDU        Location/Qualifiers
FT   CDS             complement(606487..607038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdU"
FT                   /locus_tag="SSON_0566"
FT                   /old_locus_tag="SSO_0566"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: HI; COG: COG3697"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87333"
FT                   /db_xref="GOA:Q3Z4H9"
FT                   /db_xref="InterPro:IPR005551"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z4H9"
FT                   /protein_id="AAZ87333.1"
FT                   /translation="MHLLPELASHHAVSIPELLVSRDERQARQHVWLKRHPVPLVSFTV
FT                   VAPGPIKDSEVTRRIFNHGVTALRALAAKQGWQIQEQAALVSASGPEGMLSIAAPARDL
FT                   KLATIELEHSHPLGRLWDIDVLTPEGEILSRRDYSLPPRRCLLCEQSAAVCARGKTHQL
FT                   TDLLNRMEALLNDVDACNVN"
     MHLLPELASH HAVSIPELLV SRDERQARQH VWLKRHPVPL VSFTVVAPGP IKDSEVTRRI        60
     FNHGVTALRA LAAKQGWQIQ EQAALVSASG PEGMLSIAAP ARDLKLATIE LEHSHPLGRL       120
     WDIDVLTPEG EILSRRDYSL PPRRCLLCEQ SAAVCARGKT HQLTDLLNRM EALLNDVDAC       180
     NVN                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page