(data stored in ACNUC7421 zone)

EMBL: CP000038.YBDZ

CP000038.YBDZ        Location/Qualifiers
FT   CDS             573387..573605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdZ"
FT                   /locus_tag="SSON_0536"
FT                   /old_locus_tag="SSO_0536"
FT                   /product="putative cytoplasmic protein"
FT                   /note="Code: S; COG: COG3251"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87304"
FT                   /db_xref="InterPro:IPR005153"
FT                   /db_xref="InterPro:IPR037407"
FT                   /db_xref="InterPro:IPR038020"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z4K8"
FT                   /protein_id="AAZ87304.1"
FT                   /translation="MAFSNPFDDPQGAFYILRNAQGQFSLWPQQCLLSAGWDIVCQPQS
FT                   QASCQQWLEVHWRTLTPANFTQLQEAQ"
     MAFSNPFDDP QGAFYILRNA QGQFSLWPQQ CLLSAGWDIV CQPQSQASCQ QWLEVHWRTL        60
     TPANFTQLQE AQ                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page