(data stored in ACNUC7421 zone)

EMBL: CP000038.YBEN

CP000038.YBEN        Location/Qualifiers
FT   CDS             complement(631214..631855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeN"
FT                   /locus_tag="SSON_0593"
FT                   /old_locus_tag="SSO_0593"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: H; COG: COG1057"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87359"
FT                   /db_xref="GOA:Q3Z4F3"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z4F3"
FT                   /protein_id="AAZ87359.1"
FT                   /translation="MKSLQALFGGTFDPVHYGHLKPVETLANLIGLTRVTIIPNNVPPH
FT                   RPQPEANSVQRKHMLELAIADKPLFTLDERELKRNAPSYTAQTLKEWRQEQGPDVPLAF
FT                   IIGQDSLLTFPTWYEYETILDNAHLIVCRRPGYPLEMAQPQYQQWLEDHLTHNPEDLHL
FT                   QPAGKIYLAETPWFNISATIIRERLQNGESCEDLLPEPVLTYINQQGLYR"
     MKSLQALFGG TFDPVHYGHL KPVETLANLI GLTRVTIIPN NVPPHRPQPE ANSVQRKHML        60
     ELAIADKPLF TLDERELKRN APSYTAQTLK EWRQEQGPDV PLAFIIGQDS LLTFPTWYEY       120
     ETILDNAHLI VCRRPGYPLE MAQPQYQQWL EDHLTHNPED LHLQPAGKIY LAETPWFNIS       180
     ATIIRERLQN GESCEDLLPE PVLTYINQQG LYR                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page