(data stored in ACNUC7421 zone)

EMBL: CP000038.YBES

CP000038.YBES        Location/Qualifiers
FT   CDS             638698..640125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeS"
FT                   /locus_tag="SSON_0600"
FT                   /old_locus_tag="SSO_0600"
FT                   /product="putative enzyme of polynucleotide modification"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87366"
FT                   /db_xref="GOA:Q3Z4E6"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z4E6"
FT                   /protein_id="AAZ87366.1"
FT                   /translation="MKNCWKILEIEETTDVDIIRRAYLALLLSFHPETDPQGFKQLRQA
FT                   YEEALRIAQSPAKSVWQPEEYEVAEHEILLAFRALLASDSERFLPSAWQRFIQQLNYCS
FT                   MEEIDELRWSLCTIAMNTAHLSFECVVLLAERLRWLQEENVGEIDEEELESFLYAIAKG
FT                   NVFNFQTILHLPVAVQNDTIDFYQMFARIWSSHPEWLTLYLAQHRAVIIPDDAKLHRNL
FT                   LRWYSAGRLDIPELLDYARSWREAEPDNEDARYYEYAQRVYCGEGESLLAELCDYWREY
FT                   PSTQADALILQWCRQHRVDYYPLVVMMIEARELVNDQGKQLLYVPGDSARTRFHLYEIL
FT                   SDEKLSALGRSLVEMVLHKGRKPRISLTRDTEHPLWPLYLVAKQLVQASQPTEESLMPI
FT                   VSRLDAEDRCPLEALIIRRLLIQAANFTGQETVEPEPQPQPMPVDDGGLGCLGVIKIIF
FT                   YIFIFAGLIGKILHLFG"
     MKNCWKILEI EETTDVDIIR RAYLALLLSF HPETDPQGFK QLRQAYEEAL RIAQSPAKSV        60
     WQPEEYEVAE HEILLAFRAL LASDSERFLP SAWQRFIQQL NYCSMEEIDE LRWSLCTIAM       120
     NTAHLSFECV VLLAERLRWL QEENVGEIDE EELESFLYAI AKGNVFNFQT ILHLPVAVQN       180
     DTIDFYQMFA RIWSSHPEWL TLYLAQHRAV IIPDDAKLHR NLLRWYSAGR LDIPELLDYA       240
     RSWREAEPDN EDARYYEYAQ RVYCGEGESL LAELCDYWRE YPSTQADALI LQWCRQHRVD       300
     YYPLVVMMIE ARELVNDQGK QLLYVPGDSA RTRFHLYEIL SDEKLSALGR SLVEMVLHKG       360
     RKPRISLTRD TEHPLWPLYL VAKQLVQASQ PTEESLMPIV SRLDAEDRCP LEALIIRRLL       420
     IQAANFTGQE TVEPEPQPQP MPVDDGGLGC LGVIKIIFYI FIFAGLIGKI LHLFG            475
//

If you have problems or comments...

PBIL Back to PBIL home page