(data stored in ACNUC7421 zone)

EMBL: CP000038.YBEV

CP000038.YBEV        Location/Qualifiers
FT   CDS             641495..642946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeV"
FT                   /locus_tag="SSON_0603"
FT                   /old_locus_tag="SSO_0603"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0603"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87369"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z4E3"
FT                   /protein_id="AAZ87369.1"
FT                   /translation="MKTCWQILEIESTTQIDIIRQAYLARLPLCHPETDPQGFKALRQA
FT                   YEEALRLAVNPVEEADDEEKDATAEHEILRAFRTLLDSESDRFQPSAWQKFIQQLNTWN
FT                   MEDVDQLRWPLCAIAIEARYLSLNCASLLAERLNWHSFNDSEGMDEEEREAFLEAIQAG
FT                   DCFDFLSLLEYPVALQNQTVEYYFALERCCRYHPDYVTAFLAMEGPWFIPDDAKLHRKL
FT                   LRWYSSVQTGMAELIPVAKQWQAEEPESEDARYYQCAQRLYCGEGESLLADLCAYWESY
FT                   PSTQADNLLLQWSKRHCPDYFALLVMVIEARSMVDAQGKPLKYVPGESARTRLLWAEIL
FT                   HSGKLSPLGQSFIESLFFKRKAWAWWKSRVGSETEQDSPLLDLYRVAEQVVLEAFPKQE
FT                   MLARLNTRLEGGDAHPLEAIITQMLLTKVKLEPEDEDVDEPTPENHEEKNDEDEKPQSI
FT                   TSIIKISLTVLMIGYALGKIAMLFS"
     MKTCWQILEI ESTTQIDIIR QAYLARLPLC HPETDPQGFK ALRQAYEEAL RLAVNPVEEA        60
     DDEEKDATAE HEILRAFRTL LDSESDRFQP SAWQKFIQQL NTWNMEDVDQ LRWPLCAIAI       120
     EARYLSLNCA SLLAERLNWH SFNDSEGMDE EEREAFLEAI QAGDCFDFLS LLEYPVALQN       180
     QTVEYYFALE RCCRYHPDYV TAFLAMEGPW FIPDDAKLHR KLLRWYSSVQ TGMAELIPVA       240
     KQWQAEEPES EDARYYQCAQ RLYCGEGESL LADLCAYWES YPSTQADNLL LQWSKRHCPD       300
     YFALLVMVIE ARSMVDAQGK PLKYVPGESA RTRLLWAEIL HSGKLSPLGQ SFIESLFFKR       360
     KAWAWWKSRV GSETEQDSPL LDLYRVAEQV VLEAFPKQEM LARLNTRLEG GDAHPLEAII       420
     TQMLLTKVKL EPEDEDVDEP TPENHEEKND EDEKPQSITS IIKISLTVLM IGYALGKIAM       480
     LFS                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page