(data stored in ACNUC7421 zone)

EMBL: CP000038.YHHI

CP000038.YHHI        Location/Qualifiers
FT   CDS             288388..289524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhhI"
FT                   /locus_tag="SSON_0260"
FT                   /old_locus_tag="SSO_0260"
FT                   /product="putative receptor"
FT                   /note="Code: L; COG: COG5433"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87044"
FT                   /db_xref="GOA:Q3Z5B8"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5B8"
FT                   /protein_id="AAZ87044.1"
FT                   /translation="MELKKLMEHISIIPDYRQAWKVEHKLSDILLLTICAVISGAEGWE
FT                   DIEDFGETHLDFLKQYGDFENGIPVHDTIARVVSCISPAKFHECFINWMRDCHSSDDKD
FT                   VIAIDGKTLRHSYDKSRRKGAIHVISAFSTMHSLVLGQIKTDEKSNEITAIPELLNMLD
FT                   IKGKIITTDAMGCQKDIAEKIQKQGGDYLFAVKGNQGRLNKAFEEKFPLKELNNPEHDS
FT                   YAISEKSHGREEIRLHIVCDVPDELIDFTFEWKGLKKLCVAVSFRSIIAEQKKEPEMTV
FT                   RYYISSADLTAEKFATAIRNHWHVENKLHWRLDVVMNEDDCKIRRGNAAELFSGIRHIA
FT                   INILTNDKVFKAGLRRKMRKAAMDRNYLASVLAESGLS"
     MELKKLMEHI SIIPDYRQAW KVEHKLSDIL LLTICAVISG AEGWEDIEDF GETHLDFLKQ        60
     YGDFENGIPV HDTIARVVSC ISPAKFHECF INWMRDCHSS DDKDVIAIDG KTLRHSYDKS       120
     RRKGAIHVIS AFSTMHSLVL GQIKTDEKSN EITAIPELLN MLDIKGKIIT TDAMGCQKDI       180
     AEKIQKQGGD YLFAVKGNQG RLNKAFEEKF PLKELNNPEH DSYAISEKSH GREEIRLHIV       240
     CDVPDELIDF TFEWKGLKKL CVAVSFRSII AEQKKEPEMT VRYYISSADL TAEKFATAIR       300
     NHWHVENKLH WRLDVVMNED DCKIRRGNAA ELFSGIRHIA INILTNDKVF KAGLRRKMRK       360
     AAMDRNYLAS VLAESGLS                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page