(data stored in ACNUC7421 zone)

EMBL: CP000038.YKGB

CP000038.YKGB        Location/Qualifiers
FT   CDS             351588..352190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgB"
FT                   /locus_tag="SSON_0322"
FT                   /old_locus_tag="SSO_0322"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG3059"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87100"
FT                   /db_xref="GOA:Q3Z562"
FT                   /db_xref="InterPro:IPR007339"
FT                   /db_xref="InterPro:IPR016865"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z562"
FT                   /protein_id="AAZ87100.1"
FT                   /translation="MFTMEKYLHLLSRGDKIGLSLIRLSIAIVFMWIGLLKFVPYEADS
FT                   ITPFVANSPLMSFFYEHPEDYKQYLTHEGEYKPEARAWQSANNTYGFSNGLGVVEVIIA
FT                   LLVLANPVNRWLGLLGGLMAYTTPLVTLSFLITTPEAWVPALGDAHHGFPYLSGAGRLV
FT                   LKDTLMLAGAVMIMADSAREILKQRSNESSSTLKTEY"
     MFTMEKYLHL LSRGDKIGLS LIRLSIAIVF MWIGLLKFVP YEADSITPFV ANSPLMSFFY        60
     EHPEDYKQYL THEGEYKPEA RAWQSANNTY GFSNGLGVVE VIIALLVLAN PVNRWLGLLG       120
     GLMAYTTPLV TLSFLITTPE AWVPALGDAH HGFPYLSGAG RLVLKDTLML AGAVMIMADS       180
     AREILKQRSN ESSSTLKTEY                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page