(data stored in ACNUC7421 zone)

EMBL: CP000038.YLAC

CP000038.YLAC        Location/Qualifiers
FT   CDS             complement(470976..471485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylaC"
FT                   /locus_tag="SSON_0445"
FT                   /old_locus_tag="SSO_0445"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87221"
FT                   /db_xref="GOA:Q3Z4U1"
FT                   /db_xref="InterPro:IPR019713"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z4U1"
FT                   /protein_id="AAZ87221.1"
FT                   /translation="MFPGKLQIPRRQTMTEIQRLLTETIESLNTREKRDNKPRFSISFI
FT                   RKHPGLFIGMYVAFFATLAVMLQSETLSGSVWLLVVLFILLNGFFFFDVYPRYRYEDID
FT                   VLDFRVCYNGEWYNTRFVPAALVEAILNSPRVADVHKEQLQKMIVRKGELSFYDIFTLA
FT                   RAESTS"
     MFPGKLQIPR RQTMTEIQRL LTETIESLNT REKRDNKPRF SISFIRKHPG LFIGMYVAFF        60
     ATLAVMLQSE TLSGSVWLLV VLFILLNGFF FFDVYPRYRY EDIDVLDFRV CYNGEWYNTR       120
     FVPAALVEAI LNSPRVADVH KEQLQKMIVR KGELSFYDIF TLARAESTS                   169
//

If you have problems or comments...

PBIL Back to PBIL home page