(data stored in ACNUC7421 zone)

EMBL: CP000038.YLBE

CP000038.YLBE        Location/Qualifiers
FT   CDS             complement(527449..528450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylbE"
FT                   /locus_tag="SSON_0499"
FT                   /old_locus_tag="SSO_0499"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87274"
FT                   /db_xref="InterPro:IPR009499"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z4N8"
FT                   /protein_id="AAZ87274.1"
FT                   /translation="MNFIPCHHVNAVGPMGGITSASMPMLVVENVTDGNRAYCNLNEGI
FT                   GKVMRFGAYGEDVLTRHRWMRDVLMPVLSAALGRMERGIDLTAMMAQGITMGDEFHQRN
FT                   IASSALLMRALAPQIARLDHDKQHIAEVMDFLSVTDQFFLNLAMAYCKAAMDAGAMIRA
FT                   GSIVTAMTRNGNMFGIRVSGLGERWFTAPVNTPQGLFFTGFSQEQANPDMGDSAITETF
FT                   GIGGAAMIAAPGVTRFVGAGGMEAARAVSEEMAEIYLERNMQLQIPGWDFQGACLGLDI
FT                   RRVVETDITPLINTGIAHKEAGIGQIGAGTVRAPLACFEQALEALAESMGIG"
     MNFIPCHHVN AVGPMGGITS ASMPMLVVEN VTDGNRAYCN LNEGIGKVMR FGAYGEDVLT        60
     RHRWMRDVLM PVLSAALGRM ERGIDLTAMM AQGITMGDEF HQRNIASSAL LMRALAPQIA       120
     RLDHDKQHIA EVMDFLSVTD QFFLNLAMAY CKAAMDAGAM IRAGSIVTAM TRNGNMFGIR       180
     VSGLGERWFT APVNTPQGLF FTGFSQEQAN PDMGDSAITE TFGIGGAAMI AAPGVTRFVG       240
     AGGMEAARAV SEEMAEIYLE RNMQLQIPGW DFQGACLGLD IRRVVETDIT PLINTGIAHK       300
     EAGIGQIGAG TVRAPLACFE QALEALAESM GIG                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page