(data stored in ACNUC7421 zone)

EMBL: CP000038.YLCB

CP000038.YLCB        Location/Qualifiers
FT   CDS             556042..557424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylcB"
FT                   /locus_tag="SSON_0523"
FT                   /old_locus_tag="SSO_0523"
FT                   /product="putative resistance protein"
FT                   /note="Code: MU; COG: COG1538"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87292"
FT                   /db_xref="GOA:Q3Z4M0"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z4M0"
FT                   /protein_id="AAZ87292.1"
FT                   /translation="MSPCKLLPFCVALALTGCSLAPDYQRTAMPVPQQFSLSQNGLVNA
FT                   ADNYQNVGWRTFFVDNQVKTLISEALVNNRDLRMATLKVQEARAQYRLTDADRYPQLNG
FT                   EGSGSWSGNLKGNTATTREFSTGLNASFDLDFFGRLKNMSEAERQNYLATEEAQRAVHI
FT                   LLVSNVAQSYFNQQLAYAQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIE
FT                   STRSDIAKRQGELAQANNALQLLLGSYGKLPQAQTVNSGSLQSVKLPAGLSSQILLQRP
FT                   DIMEAEHALMAANANIGAARAAFFPSISLTSGISTASSDLSSLFNASSGMWNFIPKIEI
FT                   PIFNAGRNQANLDIAEIRQQQSVVNYEQKIQNAFKEVADALALRQSLNDQISAQQRYLA
FT                   SLQITLQRARALYQHGAVSYLEVLDAERSLFATRQTLLDLNYARQVNEISLYTALGGGW
FT                   QQ"
     MSPCKLLPFC VALALTGCSL APDYQRTAMP VPQQFSLSQN GLVNAADNYQ NVGWRTFFVD        60
     NQVKTLISEA LVNNRDLRMA TLKVQEARAQ YRLTDADRYP QLNGEGSGSW SGNLKGNTAT       120
     TREFSTGLNA SFDLDFFGRL KNMSEAERQN YLATEEAQRA VHILLVSNVA QSYFNQQLAY       180
     AQLQIAEETL RNYQQSYAFV EKQLLTGSSN VLALEQARGV IESTRSDIAK RQGELAQANN       240
     ALQLLLGSYG KLPQAQTVNS GSLQSVKLPA GLSSQILLQR PDIMEAEHAL MAANANIGAA       300
     RAAFFPSISL TSGISTASSD LSSLFNASSG MWNFIPKIEI PIFNAGRNQA NLDIAEIRQQ       360
     QSVVNYEQKI QNAFKEVADA LALRQSLNDQ ISAQQRYLAS LQITLQRARA LYQHGAVSYL       420
     EVLDAERSLF ATRQTLLDLN YARQVNEISL YTALGGGWQQ                             460
//

If you have problems or comments...

PBIL Back to PBIL home page