(data stored in ACNUC7421 zone)

EMBL: CP000075.PE100

CP000075.PE100       Location/Qualifiers
FT   CDS             complement(112435..112968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35174"
FT                   /db_xref="InterPro:IPR021225"
FT                   /db_xref="UniProtKB/TrEMBL:Q500J8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35174.1"
FT                   /translation="MPMDPQSIDTNKVAHCTFELTGQPMSLLKCSNNESYEAFSGITGY
FT                   ANDPAQVSSAKNGPLPPGRYYILNRESGGRLGWLRDPITDLIARTDRSDWFSLYRDDGE
FT                   IDDRTIIDNVERENFRLHPVGPLGLSEGCVTMTSKLGFEQLSIYLHNMEGDRLPGSGQK
FT                   YFGILDVIDPRNTK"
     MPMDPQSIDT NKVAHCTFEL TGQPMSLLKC SNNESYEAFS GITGYANDPA QVSSAKNGPL        60
     PPGRYYILNR ESGGRLGWLR DPITDLIART DRSDWFSLYR DDGEIDDRTI IDNVERENFR       120
     LHPVGPLGLS EGCVTMTSKL GFEQLSIYLH NMEGDRLPGS GQKYFGILDV IDPRNTK          177
//

If you have problems or comments...

PBIL Back to PBIL home page