(data stored in SCRATCH zone)

EMBL: CP000075.PE101

CP000075.PE101       Location/Qualifiers
FT   CDS             complement(112987..113487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0101"
FT                   /product="Protein of unknown function DUF796"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35175"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:Q500J7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35175.1"
FT                   /translation="MAFDAYLKIDGIPGEALDAQFKDWIEMENFDLGASQSASVTATSA
FT                   GGATSGRARMSDLFFRKTVDKATPKLHEACCSGKHFKEVTLAVNRAGTDKLKYLEIVLE
FT                   EVIISSVSLNGNGGVEGGFPTETVRLNYGRIKMTYTQQKRADGQGGGQVVGGWDAISNK
FT                   VYA"
     MAFDAYLKID GIPGEALDAQ FKDWIEMENF DLGASQSASV TATSAGGATS GRARMSDLFF        60
     RKTVDKATPK LHEACCSGKH FKEVTLAVNR AGTDKLKYLE IVLEEVIISS VSLNGNGGVE       120
     GGFPTETVRL NYGRIKMTYT QQKRADGQGG GQVVGGWDAI SNKVYA                      166
//

If you have problems or comments...

PBIL Back to PBIL home page