(data stored in ACNUC7421 zone)

EMBL: CP000075.PE103

CP000075.PE103       Location/Qualifiers
FT   CDS             complement(114514..114891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0103"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35177"
FT                   /db_xref="InterPro:IPR019650"
FT                   /db_xref="UniProtKB/TrEMBL:Q500J5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35177.1"
FT                   /translation="MKLDKDLVREILLAIEASDKTPDSWIDLTIENHSKDEASYHVMLL
FT                   HEAGFIVAQDLCSMSDFDWRPKRLTIRGHEFLDTIRDREVWRLTKAGAEKAGGVSLTVM
FT                   LEIGKAYGKQVLKDRLGIDLP"
     MKLDKDLVRE ILLAIEASDK TPDSWIDLTI ENHSKDEASY HVMLLHEAGF IVAQDLCSMS        60
     DFDWRPKRLT IRGHEFLDTI RDREVWRLTK AGAEKAGGVS LTVMLEIGKA YGKQVLKDRL       120
     GIDLP                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page