(data stored in ACNUC7421 zone)

EMBL: CP000075.PE107

CP000075.PE107       Location/Qualifiers
FT   CDS             118370..118735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0107"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35181"
FT                   /db_xref="UniProtKB/TrEMBL:Q500J1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35181.1"
FT                   /translation="MVPDEIVMCAPHVIGEKMLAQQMAQANKELKAGIEVRMLATPTDA
FT                   SKGLGMFDALNGFEDAAALAHRSPPFSQPQEKDVFIFIHNSKHLIPLNPNPSDNTTGHI
FT                   VAPKKMACGCDESFHLA"
     MVPDEIVMCA PHVIGEKMLA QQMAQANKEL KAGIEVRMLA TPTDASKGLG MFDALNGFED        60
     AAALAHRSPP FSQPQEKDVF IFIHNSKHLI PLNPNPSDNT TGHIVAPKKM ACGCDESFHL       120
     A                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page