(data stored in SCRATCH zone)

EMBL: CP000075.PE109

CP000075.PE109       Location/Qualifiers
FT   CDS             120719..121144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35183"
FT                   /db_xref="InterPro:IPR010862"
FT                   /db_xref="UniProtKB/TrEMBL:Q500I9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35183.1"
FT                   /translation="MNKESVDYELLNDIVKCIQEVFEFSKDAFETLSLATDINRELGIE
FT                   GDDANELMPEFFERFSINIDNYDPYRYFVPEGYDFFSFRRSKDRRGKIPITLGMLYMAA
FT                   REKVWNTQELESVKFSPAPLYNCTSEIPLEDYKNNDK"
     MNKESVDYEL LNDIVKCIQE VFEFSKDAFE TLSLATDINR ELGIEGDDAN ELMPEFFERF        60
     SINIDNYDPY RYFVPEGYDF FSFRRSKDRR GKIPITLGML YMAAREKVWN TQELESVKFS       120
     PAPLYNCTSE IPLEDYKNND K                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page