(data stored in ACNUC7421 zone)

EMBL: CP000075.PE114

CP000075.PE114       Location/Qualifiers
FT   CDS             125003..125455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35188"
FT                   /db_xref="UniProtKB/TrEMBL:Q500I4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35188.1"
FT                   /translation="MLGRERAVRQFQKITSSMNPTSKVPPPETWVRVFPWSFTLKSFSK
FT                   VVAAAVCGLVLAGCTGTPMKTPHYDSSQYTVVGHSEASATGLMLFGLIPIRQNDRFVRA
FT                   QNSAIQAKGGDALINTQVQEKWFWAWVLNGYTTTVSGDVIKLKTAK"
     MLGRERAVRQ FQKITSSMNP TSKVPPPETW VRVFPWSFTL KSFSKVVAAA VCGLVLAGCT        60
     GTPMKTPHYD SSQYTVVGHS EASATGLMLF GLIPIRQNDR FVRAQNSAIQ AKGGDALINT       120
     QVQEKWFWAW VLNGYTTTVS GDVIKLKTAK                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page