(data stored in ACNUC7421 zone)

EMBL: CP000075.PE116

CP000075.PE116       Location/Qualifiers
FT   CDS             complement(126577..127209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0116"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35190"
FT                   /db_xref="GOA:Q500I2"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q500I2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35190.1"
FT                   /translation="MNVHLYLSFILTSLIVLVVPGPSFAYAIAVGMRSSRQVILRNALG
FT                   MALGGLTITMALAFGVAQLFAAYPTAFVALKFIGCTYLVALGIRTFFTRPEPKHACKIE
FT                   TSATPLLQGFIVETANPKAILFYVSLVPQFADPELGHMEAQLLILGATFVALQVTWDIA
FT                   LMLGVHRLGAIAGGLMSTKSQRIINRISGTTFIVLGLALLTQERPVS"
     MNVHLYLSFI LTSLIVLVVP GPSFAYAIAV GMRSSRQVIL RNALGMALGG LTITMALAFG        60
     VAQLFAAYPT AFVALKFIGC TYLVALGIRT FFTRPEPKHA CKIETSATPL LQGFIVETAN       120
     PKAILFYVSL VPQFADPELG HMEAQLLILG ATFVALQVTW DIALMLGVHR LGAIAGGLMS       180
     TKSQRIINRI SGTTFIVLGL ALLTQERPVS                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page