(data stored in ACNUC7421 zone)

EMBL: CP000075.PE128

CP000075.PE128       Location/Qualifiers
FT   CDS             137161..137526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0128"
FT                   /product="H-NS family protein MvaT"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35201"
FT                   /db_xref="InterPro:IPR035616"
FT                   /db_xref="UniProtKB/TrEMBL:Q500H1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35201.1"
FT                   /translation="MSKLAEYRQLEKHLAEQLQALETMKGDQGLKKEIEFETKLRKLLE
FT                   HYGFSLKHIINLLDPQTSSRGQTVEKPAGKRKPRELKVYKNPKTGEVIETKGGNHKILK
FT                   EWKAEHGSDVVEGWLKK"
     MSKLAEYRQL EKHLAEQLQA LETMKGDQGL KKEIEFETKL RKLLEHYGFS LKHIINLLDP        60
     QTSSRGQTVE KPAGKRKPRE LKVYKNPKTG EVIETKGGNH KILKEWKAEH GSDVVEGWLK       120
     K                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page