(data stored in ACNUC7421 zone)

EMBL: CP000075.PE130

CP000075.PE130       Location/Qualifiers
FT   CDS             complement(138083..138991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35203"
FT                   /db_xref="GOA:Q500G9"
FT                   /db_xref="UniProtKB/TrEMBL:Q500G9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35203.1"
FT                   /translation="MQGKQTMSIHQLRKDVEEHFQRFERAPFKEAWRRRDARICLIWMI
FT                   AWILALSATLIFLPWTKLADYMPALVPVLLISMICAVRLAEVYELVRADQMGAGPLTTP
FT                   LERSQLRQQWFCTRYSCSSAELVDKARVMRHLWEERQELKRLASNDTMGPRIAAFFRLP
FT                   DPARFIGTLFAIAAIFTTMITLGSNIDAIFAAVQDWRTIGFNILLGTFLCAEIVWLWIM
FT                   VTGMISEIGPSLLEQLGLLPMSSRRVYRYLLAVHGASEPVTPVPNATRGLLKMSSLFFM
FT                   PVGEVWAKVRTRFTARSAAMA"
     MQGKQTMSIH QLRKDVEEHF QRFERAPFKE AWRRRDARIC LIWMIAWILA LSATLIFLPW        60
     TKLADYMPAL VPVLLISMIC AVRLAEVYEL VRADQMGAGP LTTPLERSQL RQQWFCTRYS       120
     CSSAELVDKA RVMRHLWEER QELKRLASND TMGPRIAAFF RLPDPARFIG TLFAIAAIFT       180
     TMITLGSNID AIFAAVQDWR TIGFNILLGT FLCAEIVWLW IMVTGMISEI GPSLLEQLGL       240
     LPMSSRRVYR YLLAVHGASE PVTPVPNATR GLLKMSSLFF MPVGEVWAKV RTRFTARSAA       300
     MA                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page