(data stored in ACNUC7421 zone)

EMBL: CP000075.PE135

CP000075.PE135       Location/Qualifiers
FT   CDS             144401..145225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0135"
FT                   /product="outer membrane transport energization protein
FT                   TonB"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35208"
FT                   /db_xref="GOA:Q500G4"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q500G4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35208.1"
FT                   /translation="MNDAVIMKAVPSPSPDDTSTAWQGIPFSANTSRPGGLNKPQVMVL
FT                   IAASVLIHGVIWWYMQTAQPDVPEVAPQVPEMTIELTSPTPPAPEPPPPEPPPPPPPPP
FT                   PPPEPEQPVEDPDAVEPPPKPVEKPKVEKPKPVKKVEPVKKPTPPAPTPAAAPSPPAPP
FT                   TPAPAPPAPAAPPAPVKESAAVSGLASLGNPPPEYPGLALRRSWEGRVILRIKVLPNGR
FT                   AGAVEVTKSSGKPVLDEAAVEAVRNWKFIPAKRGDTPIEGFATQTIDFKLPE"
     MNDAVIMKAV PSPSPDDTST AWQGIPFSAN TSRPGGLNKP QVMVLIAASV LIHGVIWWYM        60
     QTAQPDVPEV APQVPEMTIE LTSPTPPAPE PPPPEPPPPP PPPPPPPEPE QPVEDPDAVE       120
     PPPKPVEKPK VEKPKPVKKV EPVKKPTPPA PTPAAAPSPP APPTPAPAPP APAAPPAPVK       180
     ESAAVSGLAS LGNPPPEYPG LALRRSWEGR VILRIKVLPN GRAGAVEVTK SSGKPVLDEA       240
     AVEAVRNWKF IPAKRGDTPI EGFATQTIDF KLPE                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page