(data stored in ACNUC7421 zone)

EMBL: CP000075.PE137

CP000075.PE137       Location/Qualifiers
FT   CDS             145986..146387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0137"
FT                   /product="outer membrane transport energization protein
FT                   ExbD"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35210"
FT                   /db_xref="GOA:Q500G2"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q500G2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35210.1"
FT                   /translation="MSFSTQDSDEVLSEMNVTPLVDVMLVLLVVFIVTTPLMTNAIKVN
FT                   LPKTDAVAPAEKKNPVVVSVDQDGKFYLAKSEIAPELLEKSLQDEKAKDPEIRVQLQAD
FT                   TAVNYGQVAKAMASIERSGITKISVMTAK"
     MSFSTQDSDE VLSEMNVTPL VDVMLVLLVV FIVTTPLMTN AIKVNLPKTD AVAPAEKKNP        60
     VVVSVDQDGK FYLAKSEIAP ELLEKSLQDE KAKDPEIRVQ LQADTAVNYG QVAKAMASIE       120
     RSGITKISVM TAK                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page