(data stored in ACNUC7421 zone)

EMBL: CP000075.PE138

CP000075.PE138       Location/Qualifiers
FT   CDS             146598..149312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0138"
FT                   /product="TonB-dependent receptor:TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35211"
FT                   /db_xref="GOA:Q500G1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q500G1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35211.1"
FT                   /translation="MNLPGCTLKPLALAVRRHPRALLCALAMGMSGAQAADAVDADTSG
FT                   SAVSTSAAVVPATTQLQRVEVTGSAIRRVDAETAVPITILRADDLKKQGVTTTQEMVQR
FT                   ITGSQSINNSAGSVGAGTGGASFADMRGIGANKTLVLLNGRRLANNALSGVGTPNGSAI
FT                   DLNMIPFAAIDRVEVLRDGASALYGTDAIGGVINFITKKSLTDGSLTLGGETPTASGGG
FT                   ATNDMSASWGFGDLEEDRFNVMGVFNYNKQQNLDANDRSFAKDYVPGRGLNQTSGTAYP
FT                   GNYFQGDNSANPLGRNCSGPNLIASNGICRFSTREYIDLIPQTEKTSFFGKATGKLADD
FT                   HNVSLEYFWARNNNHTDIGPAPLTGLSLDSSSPFYPGNGITPAPTDFTLDPTQPVSTAW
FT                   RETAAGPRGSSDQNTSQRFLLNFDGLVGGWDYNVGASYNQNKVLSSLTDGYISDAAMLN
FT                   GLANGTLNPFGPQTAAGQALIDANQYHGQYSSAVGRVAGLDARISREIGDWFGAGPAGI
FT                   ALGGEYRKEKMHQEYEAFVNDVSSLGADAAGSVEGDRSVKAEYAELNVPVLDSLELTAA
FT                   VRHDKYSDFGSTTNPKYSFRYQPFKQLVVRGAYSEGFRAPSLYELYAPRSTTFTQGYYN
FT                   DPVLCAGGVVQPGGNAGRDCQQQFLNNGGGNTELAPEKARNMTLGFVYQPVNNLSMGLD
FT                   FWWIHISNQIQAFPESTVFDDPNTYADRYVRAADGSIANIVTGNANLGIVKTSGVDVTL
FT                   DYRFPNTPYGQFGLGMTGTYVTRYDFQNIIDGPYTDKVGDFQGDGVISRWKHVLTGTWA
FT                   LGDTRASITNRFTSGYNDYDRTTNARVASYALWDMSVGHTFDKVLDIDAGVRNMFDRNP
FT                   PFSNQAYNFQSGYDPRYADPLGRTLFARATYHF"
     MNLPGCTLKP LALAVRRHPR ALLCALAMGM SGAQAADAVD ADTSGSAVST SAAVVPATTQ        60
     LQRVEVTGSA IRRVDAETAV PITILRADDL KKQGVTTTQE MVQRITGSQS INNSAGSVGA       120
     GTGGASFADM RGIGANKTLV LLNGRRLANN ALSGVGTPNG SAIDLNMIPF AAIDRVEVLR       180
     DGASALYGTD AIGGVINFIT KKSLTDGSLT LGGETPTASG GGATNDMSAS WGFGDLEEDR       240
     FNVMGVFNYN KQQNLDANDR SFAKDYVPGR GLNQTSGTAY PGNYFQGDNS ANPLGRNCSG       300
     PNLIASNGIC RFSTREYIDL IPQTEKTSFF GKATGKLADD HNVSLEYFWA RNNNHTDIGP       360
     APLTGLSLDS SSPFYPGNGI TPAPTDFTLD PTQPVSTAWR ETAAGPRGSS DQNTSQRFLL       420
     NFDGLVGGWD YNVGASYNQN KVLSSLTDGY ISDAAMLNGL ANGTLNPFGP QTAAGQALID       480
     ANQYHGQYSS AVGRVAGLDA RISREIGDWF GAGPAGIALG GEYRKEKMHQ EYEAFVNDVS       540
     SLGADAAGSV EGDRSVKAEY AELNVPVLDS LELTAAVRHD KYSDFGSTTN PKYSFRYQPF       600
     KQLVVRGAYS EGFRAPSLYE LYAPRSTTFT QGYYNDPVLC AGGVVQPGGN AGRDCQQQFL       660
     NNGGGNTELA PEKARNMTLG FVYQPVNNLS MGLDFWWIHI SNQIQAFPES TVFDDPNTYA       720
     DRYVRAADGS IANIVTGNAN LGIVKTSGVD VTLDYRFPNT PYGQFGLGMT GTYVTRYDFQ       780
     NIIDGPYTDK VGDFQGDGVI SRWKHVLTGT WALGDTRASI TNRFTSGYND YDRTTNARVA       840
     SYALWDMSVG HTFDKVLDID AGVRNMFDRN PPFSNQAYNF QSGYDPRYAD PLGRTLFARA       900
     TYHF                                                                    904
//

If you have problems or comments...

PBIL Back to PBIL home page